Review



mhc ii binding peptides  (Sartorius AG)


Bioz Verified Symbol Sartorius AG is a verified supplier
Bioz Manufacturer Symbol Sartorius AG manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 98

    Structured Review

    Sartorius AG mhc ii binding peptides
    Mhc Ii Binding Peptides, supplied by Sartorius AG, used in various techniques. Bioz Stars score: 98/100, based on 1290 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/Vivaspin+6+10000+MWCO+PES/pm41991935-296-3-19
    Average 98 stars, based on 1290 article reviews
    mhc ii binding peptides - by Bioz Stars, 2026-09
    98/100 stars

    Images

    Related Articles

    Immunopeptidomics:

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01-0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice.
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01- 0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..

    Binding Assay:

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01-0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice.
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01- 0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..

    Immunoprecipitation:

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01-0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..

    Article Title: Immune-induced TCR-like antibodies regulate specific T cell response in mice.
    Article Snippet: For the detection of peptides, the immunoprecipitated products were eluted using 10 % acetic acid (01- 0280-5, Sigma-Aldrich). .. For analysis of MHC-II binding peptides, the eluted immunoprecipitated products were filtered through VIVASPIN 6, MWCO 10,000, PES (VS0601, Sartorius). ..



    Similar Products

    98
    Sartorius AG mhc ii binding peptides
    Mhc Ii Binding Peptides, supplied by Sartorius AG, used in various techniques. Bioz Stars score: 98/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/Vivaspin+6+10000+MWCO+PES/pm41991935-296-3-19
    Average 98 stars, based on 1 article reviews
    mhc ii binding peptides - by Bioz Stars, 2026-09
    98/100 stars
      Buy from Supplier

    90
    Bachem mhc class ii–binding multiepitope peptides p5
    Mhc Class Ii–Binding Multiepitope Peptides P5, supplied by Bachem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/mhc+class+ii+binding+multiepitope+peptides+p5/pmc12046335-64-4-14
    Average 90 stars, based on 1 article reviews
    mhc class ii–binding multiepitope peptides p5 - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    90
    GenScript corporation mhc class ii–binding her3 multiepitope peptides
    Intratumoral activation of antitumor CD4Th1 cells inhibits spontaneous metastasis. A, MRI images of BALB-neuT mice treated with or without intramammary gland HER2-DC1 ( n = 6/group). B, Total tumor burden was recorded by MRI for experimental BALB-neuT mice ( n = 6/group). C–E, IHC HER2 and CYT 8/18 double staining for the detection of micrometastases in lung ( C ), liver ( D ), and brain ( E ) sections from BALB-neuT mice treated with or without HER2-DC1 ( n = 3/group). F, Quantification of spontaneous micrometastases in the lung and liver of experimental BALB-neuT mice ( n = 3/group). G, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice ( n = 3/group). H, Infiltration of CD4T and CD8T cells in mammary gland of HER2-DC1–treated BALB-neuT mice and control analyzed by flow cytometry ( n = 3–4/group). I, Frequency of CD4 T cells infiltration in the mammary gland of HER2-DC1–treated BALB-neuT mice and control determined by IHC ( n = 3/group). J, IFN-γ secretion after coculturing TDLNs (from experimental BALB-neuT mice) with or without HER2-DC1 individually pulsed with p5, p435, and p1209 for 72 hours by automated ELISA ( n = 2/group). K, IFN-γ secretion after restimulating splenocytes of experimental mice with rat HER2/neu peptides p5, p435, and p1209 individually and analyzed by automated ELISA ( n = 4–6/group). L, Tumor growth curves of control and intratumoral <t>HER3-DC1–treated</t> BALB/c mice bearing 4T1 TNBC tumors ( n = 9–10/group). M and N, IHC HER3 and Pan-cytokeratin (Pan-CYT) double staining for the detection and quantification of metastases in lung ( M ) and liver ( N ) sections from 4T1 TNBC spontaneous metastasis model ( n = 3/group). O, Tumor growth curves of control and intratumoral HER3-DC1–treated C57BL/6 mice bearing B16F10 melanoma with spontaneous metastasis ( n = 10/group). P, Tumor growth curves of B16-F10 high tumor burden spontaneous metastasis–bearing mice treated with or without intratumoral HER3-DC1 ( n = 7–10/group). Q, Hematoxylin and eosin staining for the detection and quantification of spontaneous metastatic nodules in lungs from experimental B16F10 melanoma spontaneous metastasis model ( O and P ; n = 5–8/group). All data are presented as mean ± SEM. P values were calculated with one- or two-tailed Student t test. i.t., intratumoral delivery; ROI, region of interest.
    Mhc Class Ii–Binding Her3 Multiepitope Peptides, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/genes+for+z+her3+1++abd++z+her3+1++z+her3+1++abd+and+z+her3+1++abd+z+her3+1/pmc12046335-87-2-11
    Average 90 stars, based on 1 article reviews
    mhc class ii–binding her3 multiepitope peptides - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    90
    GenScript corporation isqavhaahaeineagr mhc-ii binding peptide (ovalbumin 323-339
    Intratumoral activation of antitumor CD4Th1 cells inhibits spontaneous metastasis. A, MRI images of BALB-neuT mice treated with or without intramammary gland HER2-DC1 ( n = 6/group). B, Total tumor burden was recorded by MRI for experimental BALB-neuT mice ( n = 6/group). C–E, IHC HER2 and CYT 8/18 double staining for the detection of micrometastases in lung ( C ), liver ( D ), and brain ( E ) sections from BALB-neuT mice treated with or without HER2-DC1 ( n = 3/group). F, Quantification of spontaneous micrometastases in the lung and liver of experimental BALB-neuT mice ( n = 3/group). G, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice ( n = 3/group). H, Infiltration of CD4T and CD8T cells in mammary gland of HER2-DC1–treated BALB-neuT mice and control analyzed by flow cytometry ( n = 3–4/group). I, Frequency of CD4 T cells infiltration in the mammary gland of HER2-DC1–treated BALB-neuT mice and control determined by IHC ( n = 3/group). J, IFN-γ secretion after coculturing TDLNs (from experimental BALB-neuT mice) with or without HER2-DC1 individually pulsed with p5, p435, and p1209 for 72 hours by automated ELISA ( n = 2/group). K, IFN-γ secretion after restimulating splenocytes of experimental mice with rat HER2/neu peptides p5, p435, and p1209 individually and analyzed by automated ELISA ( n = 4–6/group). L, Tumor growth curves of control and intratumoral <t>HER3-DC1–treated</t> BALB/c mice bearing 4T1 TNBC tumors ( n = 9–10/group). M and N, IHC HER3 and Pan-cytokeratin (Pan-CYT) double staining for the detection and quantification of metastases in lung ( M ) and liver ( N ) sections from 4T1 TNBC spontaneous metastasis model ( n = 3/group). O, Tumor growth curves of control and intratumoral HER3-DC1–treated C57BL/6 mice bearing B16F10 melanoma with spontaneous metastasis ( n = 10/group). P, Tumor growth curves of B16-F10 high tumor burden spontaneous metastasis–bearing mice treated with or without intratumoral HER3-DC1 ( n = 7–10/group). Q, Hematoxylin and eosin staining for the detection and quantification of spontaneous metastatic nodules in lungs from experimental B16F10 melanoma spontaneous metastasis model ( O and P ; n = 5–8/group). All data are presented as mean ± SEM. P values were calculated with one- or two-tailed Student t test. i.t., intratumoral delivery; ROI, region of interest.
    Isqavhaahaeineagr Mhc Ii Binding Peptide (Ovalbumin 323 339, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/isqavhaahaeineagr+mhc+ii+binding+peptide++ovalbumin+323+339/pm37289588-198-49-55
    Average 90 stars, based on 1 article reviews
    isqavhaahaeineagr mhc-ii binding peptide (ovalbumin 323-339 - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    90
    Proimmune peptide binding assay proimmune reveal ® mhc class ii-peptide binding assay
    <t>Binding</t> affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in <t>vitro</t> ( B ) . Horizontal numbers indicate <t>peptide</t> numbers used in the study (shown in <xref ref-type= Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively. " width="250" height="auto" />
    Peptide Binding Assay Proimmune Reveal ® Mhc Class Ii Peptide Binding Assay, supplied by Proimmune, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/reveal++mhc+peptide+binding+assay/pmc10128036-251-8-12
    Average 90 stars, based on 1 article reviews
    peptide binding assay proimmune reveal ® mhc class ii-peptide binding assay - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    90
    Abfrontier ltd eα44-76 peptide (rleefakfasfeaqgalaniavdkanldvmkkr; the underlined sequence binds to mhc-ii)
    <t>Binding</t> affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in <t>vitro</t> ( B ) . Horizontal numbers indicate <t>peptide</t> numbers used in the study (shown in <xref ref-type= Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively. " width="250" height="auto" />
    Eα44 76 Peptide (Rleefakfasfeaqgalaniavdkanldvmkkr; The Underlined Sequence Binds To Mhc Ii), supplied by Abfrontier ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/e%CE%B144+76+peptide++rleefakfasfeaqgalaniavdkanldvmkkr++the+underlined+sequence+binds+to+mhc+ii+/pm33706053-62-1-13
    Average 90 stars, based on 1 article reviews
    eα44-76 peptide (rleefakfasfeaqgalaniavdkanldvmkkr; the underlined sequence binds to mhc-ii) - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    90
    Immunome Inc mhc class ii binding peptides
    <t>Binding</t> affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in <t>vitro</t> ( B ) . Horizontal numbers indicate <t>peptide</t> numbers used in the study (shown in <xref ref-type= Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively. " width="250" height="auto" />
    Mhc Class Ii Binding Peptides, supplied by Immunome Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/mhc+class+ii+binding+peptides/us11013781-2050-2-13
    Average 90 stars, based on 1 article reviews
    mhc class ii binding peptides - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    98
    Sartorius AG vivaspin 100 pes centrifugal concentrator
    <t>Binding</t> affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in <t>vitro</t> ( B ) . Horizontal numbers indicate <t>peptide</t> numbers used in the study (shown in <xref ref-type= Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively. " width="250" height="auto" />
    Vivaspin 100 Pes Centrifugal Concentrator, supplied by Sartorius AG, used in various techniques. Bioz Stars score: 98/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/mhc+ii+binding+peptides/Vivaspin+100+PES+Centrifugal+Concentrator/custom%40vc1012%4029442808
    Average 98 stars, based on 1 article reviews
    vivaspin 100 pes centrifugal concentrator - by Bioz Stars, 2026-09
    98/100 stars
      Buy from Supplier

    Image Search Results


    Intratumoral activation of antitumor CD4Th1 cells inhibits spontaneous metastasis. A, MRI images of BALB-neuT mice treated with or without intramammary gland HER2-DC1 ( n = 6/group). B, Total tumor burden was recorded by MRI for experimental BALB-neuT mice ( n = 6/group). C–E, IHC HER2 and CYT 8/18 double staining for the detection of micrometastases in lung ( C ), liver ( D ), and brain ( E ) sections from BALB-neuT mice treated with or without HER2-DC1 ( n = 3/group). F, Quantification of spontaneous micrometastases in the lung and liver of experimental BALB-neuT mice ( n = 3/group). G, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice ( n = 3/group). H, Infiltration of CD4T and CD8T cells in mammary gland of HER2-DC1–treated BALB-neuT mice and control analyzed by flow cytometry ( n = 3–4/group). I, Frequency of CD4 T cells infiltration in the mammary gland of HER2-DC1–treated BALB-neuT mice and control determined by IHC ( n = 3/group). J, IFN-γ secretion after coculturing TDLNs (from experimental BALB-neuT mice) with or without HER2-DC1 individually pulsed with p5, p435, and p1209 for 72 hours by automated ELISA ( n = 2/group). K, IFN-γ secretion after restimulating splenocytes of experimental mice with rat HER2/neu peptides p5, p435, and p1209 individually and analyzed by automated ELISA ( n = 4–6/group). L, Tumor growth curves of control and intratumoral HER3-DC1–treated BALB/c mice bearing 4T1 TNBC tumors ( n = 9–10/group). M and N, IHC HER3 and Pan-cytokeratin (Pan-CYT) double staining for the detection and quantification of metastases in lung ( M ) and liver ( N ) sections from 4T1 TNBC spontaneous metastasis model ( n = 3/group). O, Tumor growth curves of control and intratumoral HER3-DC1–treated C57BL/6 mice bearing B16F10 melanoma with spontaneous metastasis ( n = 10/group). P, Tumor growth curves of B16-F10 high tumor burden spontaneous metastasis–bearing mice treated with or without intratumoral HER3-DC1 ( n = 7–10/group). Q, Hematoxylin and eosin staining for the detection and quantification of spontaneous metastatic nodules in lungs from experimental B16F10 melanoma spontaneous metastasis model ( O and P ; n = 5–8/group). All data are presented as mean ± SEM. P values were calculated with one- or two-tailed Student t test. i.t., intratumoral delivery; ROI, region of interest.

    Journal: Cancer Immunology Research

    Article Title: Antitumor CD4 + T Helper 1 Cells Target and Control the Outgrowth of Disseminated Cancer Cells

    doi: 10.1158/2326-6066.CIR-24-0630

    Figure Lengend Snippet: Intratumoral activation of antitumor CD4Th1 cells inhibits spontaneous metastasis. A, MRI images of BALB-neuT mice treated with or without intramammary gland HER2-DC1 ( n = 6/group). B, Total tumor burden was recorded by MRI for experimental BALB-neuT mice ( n = 6/group). C–E, IHC HER2 and CYT 8/18 double staining for the detection of micrometastases in lung ( C ), liver ( D ), and brain ( E ) sections from BALB-neuT mice treated with or without HER2-DC1 ( n = 3/group). F, Quantification of spontaneous micrometastases in the lung and liver of experimental BALB-neuT mice ( n = 3/group). G, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice ( n = 3/group). H, Infiltration of CD4T and CD8T cells in mammary gland of HER2-DC1–treated BALB-neuT mice and control analyzed by flow cytometry ( n = 3–4/group). I, Frequency of CD4 T cells infiltration in the mammary gland of HER2-DC1–treated BALB-neuT mice and control determined by IHC ( n = 3/group). J, IFN-γ secretion after coculturing TDLNs (from experimental BALB-neuT mice) with or without HER2-DC1 individually pulsed with p5, p435, and p1209 for 72 hours by automated ELISA ( n = 2/group). K, IFN-γ secretion after restimulating splenocytes of experimental mice with rat HER2/neu peptides p5, p435, and p1209 individually and analyzed by automated ELISA ( n = 4–6/group). L, Tumor growth curves of control and intratumoral HER3-DC1–treated BALB/c mice bearing 4T1 TNBC tumors ( n = 9–10/group). M and N, IHC HER3 and Pan-cytokeratin (Pan-CYT) double staining for the detection and quantification of metastases in lung ( M ) and liver ( N ) sections from 4T1 TNBC spontaneous metastasis model ( n = 3/group). O, Tumor growth curves of control and intratumoral HER3-DC1–treated C57BL/6 mice bearing B16F10 melanoma with spontaneous metastasis ( n = 10/group). P, Tumor growth curves of B16-F10 high tumor burden spontaneous metastasis–bearing mice treated with or without intratumoral HER3-DC1 ( n = 7–10/group). Q, Hematoxylin and eosin staining for the detection and quantification of spontaneous metastatic nodules in lungs from experimental B16F10 melanoma spontaneous metastasis model ( O and P ; n = 5–8/group). All data are presented as mean ± SEM. P values were calculated with one- or two-tailed Student t test. i.t., intratumoral delivery; ROI, region of interest.

    Article Snippet: All these MHC class II–binding HER3 multiepitope peptides were purchased from GenScript.

    Techniques: Activation Assay, Double Staining, Control, Flow Cytometry, Enzyme-linked Immunosorbent Assay, Staining, Two Tailed Test

    Antitumor CD4 Th1 cells are primarily responsible for metastatic prevention. A, Total tumor burden was calculated for control and HER2-DC–treated BALB-neuT mice with or without CD4 or CD8 T-cell depletion by MRI ( n = 4–6/group). B, IHC HER2 and cytokeratin 8/18 double staining for micrometastasis detection and quantification in lung and liver sections for experimental BALB-neuT mice ( n = 3/group). C, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice by IHC HER2 and cytokeratin 8/18 double staining ( n = 3/group). D, Tumor growth curves of control and intratumoral HER3-DC1–treated mice bearing 4T1 tumors depleted with or without CD4 or CD8 T cells ( n = 6–10/group). E and F, Hematoxylin and eosin staining for the detection and quantification of metastatic nodules in lung ( E ) and liver ( F ) from experimental 4T1 TNBC mice model ( n = 3–8/group). G, Tumor growth curves of CD4 knockout mice bearing B16-F10 spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 6/group). H, Quantification of spontaneous lung metastatic nodules from CD4 knockout mice model ( G ; n = 5–6/group). I, 4T1 TNBC tumor–bearing mice treated with HER3-DC1 s.c. and intratumoral HER3-DC1, immature HER3-iDC, unpulsed DC1, or HER2-DC1 ( n = 10/group). J, Quantification of spontaneous metastatic nodules in lungs from 4T1 TNBC mice model by hematoxylin and eosin staining ( n = 5–10/group). K and L, Detection ( K ) and frequency ( L ) of CD4 + IFN-γ + T cells in control and intratumoral HER3-DC1–treated 4T1 TNBC tumors analyzed by flow cytometry ( n = 2–3/group). M, Tumor growth curves of 4T1 TNBC tumor–bearing mice treated with intratumoral HER3-DC1 with or without IFN-γ neutralizing antibody ( n = 9–10/group). N, Quantification of metastatic nodules in lungs from 4T1 TNBC spontaneous metastasis mice model determined by hematoxylin and eosin staining ( n = 7–10/group). O, Tumor growth curves of IFN-γ knockout mice bearing B16F10 melanoma spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 10/group). P, Frequency of spontaneous metastatic nodules in lungs from IFN-γ knockout mice bearing B16F10 melanoma spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 4–5/group). Mean ± SEM represented. P values were determined by one- or two-tailed Student t test. ns, not significant; ROI, region of interest; SSC-A, side scatter area.

    Journal: Cancer Immunology Research

    Article Title: Antitumor CD4 + T Helper 1 Cells Target and Control the Outgrowth of Disseminated Cancer Cells

    doi: 10.1158/2326-6066.CIR-24-0630

    Figure Lengend Snippet: Antitumor CD4 Th1 cells are primarily responsible for metastatic prevention. A, Total tumor burden was calculated for control and HER2-DC–treated BALB-neuT mice with or without CD4 or CD8 T-cell depletion by MRI ( n = 4–6/group). B, IHC HER2 and cytokeratin 8/18 double staining for micrometastasis detection and quantification in lung and liver sections for experimental BALB-neuT mice ( n = 3/group). C, Quantification of metastatic cancer cells seeding in brain of experimental BALB-neuT mice by IHC HER2 and cytokeratin 8/18 double staining ( n = 3/group). D, Tumor growth curves of control and intratumoral HER3-DC1–treated mice bearing 4T1 tumors depleted with or without CD4 or CD8 T cells ( n = 6–10/group). E and F, Hematoxylin and eosin staining for the detection and quantification of metastatic nodules in lung ( E ) and liver ( F ) from experimental 4T1 TNBC mice model ( n = 3–8/group). G, Tumor growth curves of CD4 knockout mice bearing B16-F10 spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 6/group). H, Quantification of spontaneous lung metastatic nodules from CD4 knockout mice model ( G ; n = 5–6/group). I, 4T1 TNBC tumor–bearing mice treated with HER3-DC1 s.c. and intratumoral HER3-DC1, immature HER3-iDC, unpulsed DC1, or HER2-DC1 ( n = 10/group). J, Quantification of spontaneous metastatic nodules in lungs from 4T1 TNBC mice model by hematoxylin and eosin staining ( n = 5–10/group). K and L, Detection ( K ) and frequency ( L ) of CD4 + IFN-γ + T cells in control and intratumoral HER3-DC1–treated 4T1 TNBC tumors analyzed by flow cytometry ( n = 2–3/group). M, Tumor growth curves of 4T1 TNBC tumor–bearing mice treated with intratumoral HER3-DC1 with or without IFN-γ neutralizing antibody ( n = 9–10/group). N, Quantification of metastatic nodules in lungs from 4T1 TNBC spontaneous metastasis mice model determined by hematoxylin and eosin staining ( n = 7–10/group). O, Tumor growth curves of IFN-γ knockout mice bearing B16F10 melanoma spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 10/group). P, Frequency of spontaneous metastatic nodules in lungs from IFN-γ knockout mice bearing B16F10 melanoma spontaneous metastasis treated with or without intratumoral HER3-DC1 ( n = 4–5/group). Mean ± SEM represented. P values were determined by one- or two-tailed Student t test. ns, not significant; ROI, region of interest; SSC-A, side scatter area.

    Article Snippet: All these MHC class II–binding HER3 multiepitope peptides were purchased from GenScript.

    Techniques: Control, Double Staining, Staining, Knock-Out, Flow Cytometry, Two Tailed Test

    Antitumor CD4 Th1 cells target DCCs. A, Infiltration of CD4 T cells in the BM of experimental BALB-neuT mice analyzed by flow cytometry ( n = 3–5/group). B and C, HER2 + CYT8/18 + Ki-67 + DCCs in BM ( B ) and lung ( C ) of experimental BALB-neuT mice were determined by flow cytometry ( n = 2–6/group). D and E, SA-β-gal staining for the detection ( D ) and percentage of senescent DCCs ( E ) in the BM of experimental BALB-neuT mice ( n = 5–8). Scale bars, 1 mm. F, Immunoblots for HER2, NR2F1, Wnt4, and Twist proteins in BM DCCs of control and HER2-DC1–treated BALB-neuT mice. G, Immunofluorescence staining of HER2 + CYT8/18 + Ki-67 + DCCs in BM of experimental BALB-neuT mice. Scale bars, 100 μm. H, Percentage of senescent DCCs induced by tumor antigen–specific CD4 Th1 cells secreting IFN-γ on DCCs from the BM of control BALB-neuT mice ( n = 5–10). I, Frequency of CD45 − EpCAM + DCCs (among the 100% of CD45-negative cell population) in the BM of mice bearing 4T1 TNBC spontaneous metastasis receiving various treatment analyzed by flow cytometry ( n = 3/group). J and K, Detection ( J ) and frequency ( K ) of CD4 + IFN-γ + T cells in the BM of control and intratumoral HER3-DC1–treated mice bearing 4T1 TNBC spontaneous metastasis determined by flow cytometry ( n = 2–3/group). L, Tumor growth curves of NSG mice ( n = 4/group). M and N, IHC HER2 and CYT8/18 double staining for the detection of micrometastasis in lung ( M ) and liver ( N ) sections from L ( n = 4). All data are presented as mean ± SEM represented. P values were calculated by one- or two-tailed Student t test and one-way ANOVA with Tukey multiple comparisons test.

    Journal: Cancer Immunology Research

    Article Title: Antitumor CD4 + T Helper 1 Cells Target and Control the Outgrowth of Disseminated Cancer Cells

    doi: 10.1158/2326-6066.CIR-24-0630

    Figure Lengend Snippet: Antitumor CD4 Th1 cells target DCCs. A, Infiltration of CD4 T cells in the BM of experimental BALB-neuT mice analyzed by flow cytometry ( n = 3–5/group). B and C, HER2 + CYT8/18 + Ki-67 + DCCs in BM ( B ) and lung ( C ) of experimental BALB-neuT mice were determined by flow cytometry ( n = 2–6/group). D and E, SA-β-gal staining for the detection ( D ) and percentage of senescent DCCs ( E ) in the BM of experimental BALB-neuT mice ( n = 5–8). Scale bars, 1 mm. F, Immunoblots for HER2, NR2F1, Wnt4, and Twist proteins in BM DCCs of control and HER2-DC1–treated BALB-neuT mice. G, Immunofluorescence staining of HER2 + CYT8/18 + Ki-67 + DCCs in BM of experimental BALB-neuT mice. Scale bars, 100 μm. H, Percentage of senescent DCCs induced by tumor antigen–specific CD4 Th1 cells secreting IFN-γ on DCCs from the BM of control BALB-neuT mice ( n = 5–10). I, Frequency of CD45 − EpCAM + DCCs (among the 100% of CD45-negative cell population) in the BM of mice bearing 4T1 TNBC spontaneous metastasis receiving various treatment analyzed by flow cytometry ( n = 3/group). J and K, Detection ( J ) and frequency ( K ) of CD4 + IFN-γ + T cells in the BM of control and intratumoral HER3-DC1–treated mice bearing 4T1 TNBC spontaneous metastasis determined by flow cytometry ( n = 2–3/group). L, Tumor growth curves of NSG mice ( n = 4/group). M and N, IHC HER2 and CYT8/18 double staining for the detection of micrometastasis in lung ( M ) and liver ( N ) sections from L ( n = 4). All data are presented as mean ± SEM represented. P values were calculated by one- or two-tailed Student t test and one-way ANOVA with Tukey multiple comparisons test.

    Article Snippet: All these MHC class II–binding HER3 multiepitope peptides were purchased from GenScript.

    Techniques: Flow Cytometry, Staining, Western Blot, Control, Immunofluorescence, Double Staining, Two Tailed Test

    Binding affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in vitro ( B ) . Horizontal numbers indicate peptide numbers used in the study (shown in <xref ref-type= Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively. " width="100%" height="100%">

    Journal: Frontiers in Immunology

    Article Title: Amino acid polymorphisms in human histocompatibility leukocyte antigen class II and proinsulin epitope have impacts on type 1 diabetes mellitus induced by immune-checkpoint inhibitors

    doi: 10.3389/fimmu.2023.1165004

    Figure Lengend Snippet: Binding affinities of the peptides derived from human proinsulin to HLA-DP5 (HLA- DPA1*02:02 , HLA- DPB1*05:01 ) or HLA-DP15 (HLA -DPA1*02:02 , HLA- DPB1*15:01 ) molecules are shown as %RANK in silico (A) , and shown as REVEAL score in vitro ( B ) . Horizontal numbers indicate peptide numbers used in the study (shown in Table 4 ). Note that lower %RANK means predicted strong binder in silico , and higher REVEAL score indicates peptide with high affinity in vitro . Cluster 1 (peptides 6-10) and Cluster 2 (peptide 31-34) were shown with blue and red line, respectively.

    Article Snippet: The synthesized peptides were subjected to an in vitro peptide binding assay (ProImmune REVEAL ® MHC class II-peptide binding assay: (ProImmune, Oxford, UK) using recombinant HLA-DP5 and HLA-DP15 proteins.Detection of binding peptides is based on the presence or absence of the native conformation of the MHC-peptide complex in an immunoassay.

    Techniques: Binding Assay, Derivative Assay, In Silico, In Vitro